Welcome to USA Cars Parts
Lithuania Language
USD USDUSD USD
EUR Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Kategorijos
Krepšelis
0
Product Details
Bagažinės dangčio atrama, guma, bamperis, Lift Gate Buffer, KAIRĖ / DEŠINĖ, SUBARU FORESTER TRIBECA IMPREZA CROSSTREK OUTBACK 2011 - 2018
Bagažinės dangčio atrama, guma, bamperis, Lift Gate Buffer, KAIRĖ / DEŠINĖ, SUBARU FORESTER TRIBECA IMPREZA CROSSTREK OUTBACK 2011 - 2018
Bagažinės dangčio atrama, guma, bamperis, Lift Gate Buffer, KAIRĖ / DEŠINĖ, SUBARU FORESTER TRIBECA IMPREZA CROSSTREK OUTBACK 2011 - 2018
Bagažinės dangčio atrama, guma, bamperis, Lift Gate Buffer, KAIRĖ / DEŠINĖ, SUBARU FORESTER TRIBECA IMPREZA CROSSTREK OUTBACK 2011 - 2018

Bagažinės dangčio atrama, guma, bamperis, Lift Gate Buffer, KAIRĖ / DEŠINĖ, SUBARU FORESTER TRIBECA IMPREZA CROSSTREK OUTBACK 2011 - 2018

Product Code: 63112AG100 63112AG110 bagazines dangcio
Product Condition: Naujienos
Units in Stock: 1
5,00 € inc. tax
 Add to Cart
Description
Lift Gate Buffer
63112AG000 63112AG010
Right Left

THIS PART ALSO FITS

Make Model Year Body & Trim Engine & Transmission
Subaru Forester 2018 2.0XT Premium, 2.0XT Touring, 2.5i, 2.5i Limited, 2.5i Premium, 2.5i Touring 2.0L H4 - Gas, 2.5L H4 - Gas
Subaru Forester 2017 2.0XT Premium, 2.0XT Touring, 2.5i, 2.5i Limited, 2.5i Premium, 2.5i Touring 2.0L H4 - Gas, 2.5L H4 - Gas
Subaru Forester 2016 2.0XT Premium, 2.0XT Touring, 2.5i, 2.5i Limited, 2.5i Premium, 2.5i Touring 2.0L H4 - Gas, 2.5L H4 - Gas
Subaru Forester 2015 2.0XT Premium, 2.0XT Touring, 2.5i, 2.5i Limited, 2.5i Premium, 2.5i Touring 2.0L H4 - Gas, 2.5L H4 - Gas
Subaru Forester 2014 2.0XT Premium, 2.0XT Touring, 2.5i, 2.5i Limited, 2.5i Premium, 2.5i Touring 2.0L H4 - Gas, 2.5L H4 - Gas
Subaru Impreza 2016 Base, Limited, Premium, Sport Limited, Sport Premium 2.0L H4 - Gas
Subaru Impreza 2015 Base, Limited, Premium, Sport Limited, Sport Premium 2.0L H4 - Gas
Subaru Impreza 2014 Base, Limited, Premium, Sport Limited, Sport Premium 2.0L H4 - Gas
Subaru Impreza 2013 Base, Limited, Premium, Sport Limited, Sport Premium 2.0L H4 - Gas
Subaru Impreza 2012 Base, Limited, Premium, Sport Limited, Sport Premium 2.0L H4 - Gas
Subaru Outback 2014 2.5i, 2.5i Limited, 2.5i Premium, 3.6R Limited 2.5L H4 - Gas, 3.6L H6 - Gas
Subaru Outback 2013 2.5i, 2.5i Limited, 2.5i Premium, 3.6R, 3.6R Limited 2.5L H4 - Gas, 3.6L H6 - Gas
Subaru Outback 2012 2.5i, 2.5i Limited, 2.5i Premium, 3.6R, 3.6R Limited, 3.6R Premium 2.5L H4 - Gas, 3.6L H6 - Gas
Subaru Outback 2011 2.5i, 2.5i Limited, 2.5i Premium, 3.6R, 3.6R Limited, 3.6R Premium 2.5L H4 - Gas, 3.6L H6 - Gas
Subaru Tribeca 2014 Limited 3.6L H6 - Gas
Subaru Tribeca 2013 Limited 3.6L H6 - Gas
Subaru Tribeca 2012 Limited, Premium, Touring 3.6L H6 - Gas
Subaru XV Crosstrek 2015 Base, Hybrid, Hybrid Touring, Limited, Premium 2.0L H4 - Electric/Gas, 2.0L H4 - Gas
Subaru XV Crosstrek 2014 Hybrid, Hybrid Touring, Limited, Premium 2.0L H4 - Electric/Gas, 2.0L H4 - Gas
Subaru XV Crosstrek 2013 Limited, Premium 2.0L H4 - Gas

Product Added to your Cart
x

-------- ar --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i