Welcome to USA Cars Parts
Lithuania Language
USD USDUSD USD
EUR Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Kategorijos
Krepšelis
0
Product Details
Galinis stabdžių suportas, KAIRĖ, Caliper, SUBARU FORESTER IMPREZA CROSSTREK 2012 - 2019
Galinis stabdžių suportas, KAIRĖ, Caliper, SUBARU FORESTER IMPREZA CROSSTREK 2012 - 2019
Galinis stabdžių suportas, KAIRĖ, Caliper, SUBARU FORESTER IMPREZA CROSSTREK 2012 - 2019
Galinis stabdžių suportas, KAIRĖ, Caliper, SUBARU FORESTER IMPREZA CROSSTREK 2012 - 2019
Galinis stabdžių suportas, KAIRĖ, Caliper, SUBARU FORESTER IMPREZA CROSSTREK 2012 - 2019
Galinis stabdžių suportas, KAIRĖ, Caliper, SUBARU FORESTER IMPREZA CROSSTREK 2012 - 2019

Galinis stabdžių suportas, KAIRĖ, Caliper, SUBARU FORESTER IMPREZA CROSSTREK 2012 - 2019

Product Code: 26692SG010 26692FJ010 stabdziu
Brand: Subaru Forester
Product Condition: Naudota
Units in Stock: 1
weight: 5000.0g
40,00 € inc. tax
 Add to Cart
Description
Caliper Assembly
Part number: 26692SG010
26692FJ010
Left
Caliper, Disk Brake Kit Rear Left Hand

THIS PART ALSO FITS

Make Model Year Body & Trim Engine & Transmission
Subaru Crosstrek 2019 Base, Limited, Premium 2.0L H4 - Gas
Subaru Crosstrek 2018 Base, Limited, Premium 2.0L H4 - Gas
Subaru Crosstrek 2017 Base, Limited, Premium 2.0L H4 - Gas
Subaru Crosstrek 2016 Base, Hybrid, Hybrid Touring, Limited, Premium 2.0L H4 - Electric/Gas, 2.0L H4 - Gas
Subaru Forester 2018 2.5i, 2.5i Limited, 2.5i Premium, 2.5i Touring 2.5L H4 - Gas
Subaru Forester 2017 2.5i, 2.5i Limited, 2.5i Premium, 2.5i Touring 2.5L H4 - Gas
Subaru Forester 2016 2.5i, 2.5i Limited, 2.5i Premium, 2.5i Touring 2.5L H4 - Gas
Subaru Forester 2015 2.0XT Premium, 2.0XT Touring, 2.5i, 2.5i Limited, 2.5i Premium, 2.5i Touring 2.0L H4 - Gas, 2.5L H4 - Gas
Subaru Forester 2014 2.0XT Premium, 2.0XT Touring, 2.5i, 2.5i Limited, 2.5i Premium, 2.5i Touring 2.0L H4 - Gas, 2.5L H4 - Gas
Subaru Impreza 2019 Base, Limited, Premium, Sport 2.0L H4 - Gas
Subaru Impreza 2018 Base, Limited, Premium, Sport 2.0L H4 - Gas
Subaru Impreza 2017 Base, Limited, Premium, Sport 2.0L H4 - Gas
Subaru Impreza 2016 Base, Limited, Premium, Sport Limited, Sport Premium 2.0L H4 - Gas
Subaru Impreza 2015 Base, Limited, Premium, Sport Limited, Sport Premium 2.0L H4 - Gas
Subaru Impreza 2014 Base, Limited, Premium, Sport Limited, Sport Premium 2.0L H4 - Gas
Subaru Impreza 2013 Base, Limited, Premium, Sport Limited, Sport Premium 2.0L H4 - Gas
Subaru Impreza 2012 Base, Limited, Premium, Sport Limited, Sport Premium 2.0L H4 - Gas
Subaru XV Crosstrek 2015 Base, Hybrid, Hybrid Touring, Limited, Premium 2.0L H4 - Electric/Gas, 2.0L H4 - Gas
Subaru XV Crosstrek 2014 Hybrid, Hybrid Touring, Limited, Premium 2.0L H4 - Electric/Gas, 2.0L H4 - Gas
Subaru XV Crosstrek 2013 Limited, Premium 2.0L H4 - Gas
Related Products
Product Added to your Cart
x

-------- ar --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i